PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0038s0144.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 589aa    MW: 64347.7 Da    PI: 4.8576
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0038s0144.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.3e-33178234259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vkgsefprsYY+Ct+++C+v+k+ver++ d++++ei+Y+++Hnh+
  Kalax.0038s0144.2.p 178 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEVRKQVERTH-DGQITEIVYKSNHNHP 234
                          7***************************************9.***************8 PP

2WRKY104.55.8e-33368426159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +d+k+v++tYeg+Hnhe
  Kalax.0038s0144.2.p 368 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPGCLVRKHVERAPDDNKCVVTTYEGKHNHE 426
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.2E-29170236IPR003657WRKY domain
PROSITE profilePS5081124.398172236IPR003657WRKY domain
SuperFamilySSF1182906.15E-26174236IPR003657WRKY domain
SMARTSM007741.4E-36177235IPR003657WRKY domain
PfamPF031065.8E-26178234IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.2E-35353428IPR003657WRKY domain
SuperFamilySSF1182901.16E-28363428IPR003657WRKY domain
PROSITE profilePS5081136.896363428IPR003657WRKY domain
SMARTSM007746.0E-38368427IPR003657WRKY domain
PfamPF031065.2E-25369426IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MEPPDEYAAE EWNPAAAGSS SSSAPRMNPD PLIDPAVMMI PNSQPSPTTG SYYSPPFNQD  60
LSFLTNSMAA PTAAGGYCDS LPSFHGSEHP AGEVNNLHYF KDLETQDLDG GFLNLPSQQL  120
LLEFELPVLS NEFIASASIR NDYIDRNDPM YIDGAADHVM EEEKRASSPR MGGMRTTEDG  180
YNWRKYGQKQ VKGSEFPRSY YKCTHPNCEV RKQVERTHDG QITEIVYKSN HNHPQPMPNR  240
RLTPDSAFAQ NEMDAGEGCG GGTSRGKNEG LDRALSEPIL TELSRTGREK RFGAFDSSEA  300
AELASPLHNH AAEDDEAVEE NMVDANEVHN DATDLRRAED CMVEPSMSSR GVREQKIVVE  360
IETEVDILDD GYRWRKYGQK VVKGNPNPRS YYKCTTPGCL VRKHVERAPD DNKCVVTTYE  420
GKHNHEVPAA KNSSNASPNA GHLSSAHPVG QPSHMPLAGS AAMTMPTQAQ FQPPPFESKP  480
YMGNGFSAHS LPGNFGNDVS FGASSMYPMQ YGSFGLAASY PNIQRAGLSI SRSPILDSAA  540
ANPMTLHYGF DNHRGGGVIQ TAHPGDENDP TRRGPKQDEA NDEPADDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-35173429778Probable WRKY transcription factor 4
2lex_A4e-35173429778Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGLYMA18G47741.12e-98(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.14e-73WRKY family protein